Anti-SF3B5
Artikelnummer:
ATA-HPA054408
- Bilder (8)
| Artikelname: | Anti-SF3B5 |
| Artikelnummer: | ATA-HPA054408 |
| Hersteller Artikelnummer: | HPA054408 |
| Alternativnummer: | ATA-HPA054408-100,ATA-HPA054408-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MGC3133, SF3b10, Ysf3 |
| splicing factor 3b, subunit 5, 10kDa |
| Anti-SF3B5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 83443 |
| UniProt: | Q9BWJ5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SF3B5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human bone marrow shows moderate nuclear positivity in hematopoietic cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 |
|
|
HPA054408-100ul |
|
|
|
|
|
|
|
|
HPA054408-100ul |
|
|
HPA054408-100ul |
Produktgarantie und fachkundiger Support
