Anti-SF3B5

Catalog Number: ATA-HPA054408
Article Name: Anti-SF3B5
Biozol Catalog Number: ATA-HPA054408
Supplier Catalog Number: HPA054408
Alternative Catalog Number: ATA-HPA054408-100,ATA-HPA054408-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC3133, SF3b10, Ysf3
splicing factor 3b, subunit 5, 10kDa
Anti-SF3B5
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 83443
UniProt: Q9BWJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SF3B5
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemical staining of human bone marrow shows moderate nuclear positivity in hematopoietic cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
HPA054408-100ul
HPA054408-100ul
HPA054408-100ul