Anti-MCTP2

Artikelnummer: ATA-HPA054752
Artikelname: Anti-MCTP2
Artikelnummer: ATA-HPA054752
Hersteller Artikelnummer: HPA054752
Alternativnummer: ATA-HPA054752-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: WB
Spezies Reaktivität: Human
Alternative Synonym: FLJ11175, FLJ33303
Rabbit Polyclonal MCTP2 Antibody against Human multiple C2 and transmembrane domain containing 2. Validated for Western Blot
Klonalität: Polyclonal
Konzentration: 0.05
NCBI: 55784
UniProt: Q6DN12
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Sequenz: RHRWSNRKRLSASKSSLIRNLRLSESLKKNQLWNGIISITLLEGKNVSGGSMTEMFVQLKLGDQRYKSKTLCKSANPQW
WB Image Caption 1