Anti-MCTP2, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-MCTP2, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA054752
• Supplier Catalog Number: HPA054752
• Alternative Catalog Number: ATA-HPA054752-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: FLJ11175, FLJ33303

Product Description

Rabbit Polyclonal MCTP2 Antibody against Human multiple C2 and transmembrane domain containing 2. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05
• NCBI: 55784
• UniProt: Q6DN12
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: RHRWSNRKRLSASKSSLIRNLRLSESLKKNQLWNGIISITLLEGKNVSGGSMTEMFVQLKLGDQRYKSKTLCKSANPQW