Anti-PTPRK
Artikelnummer:
ATA-HPA054822
- Bilder (9)
| Artikelname: | Anti-PTPRK |
| Artikelnummer: | ATA-HPA054822 |
| Hersteller Artikelnummer: | HPA054822 |
| Alternativnummer: | ATA-HPA054822-100,ATA-HPA054822-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | R-PTP-kappa |
| protein tyrosine phosphatase, receptor type, K |
| Anti-PTPRK |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5796 |
| UniProt: | Q15262 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAESSRLLDVPRYLCE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PTPRK |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line SiHa shows localization to plasma membrane & cell junctions. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate positivity in a subset of neural fibers. |
|
|
Immunohistochemical staining of human endometrium shows moderate positivity in apical membranes in glandular cells. |
|
|
Immunohistochemical staining of human prostate shows moderate positivity in apical membranes in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected. |
|
|
HPA054822-100ul |
|
|
|
|
|
HPA054822-100ul |
|
|
HPA054822-100ul |
Produktgarantie und fachkundiger Support
