Anti-PTPRK
Catalog Number:
ATA-HPA054822
- Images (9)
| Article Name: | Anti-PTPRK |
| Biozol Catalog Number: | ATA-HPA054822 |
| Supplier Catalog Number: | HPA054822 |
| Alternative Catalog Number: | ATA-HPA054822-100,ATA-HPA054822-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | R-PTP-kappa |
| protein tyrosine phosphatase, receptor type, K |
| Anti-PTPRK |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 5796 |
| UniProt: | Q15262 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAESSRLLDVPRYLCE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PTPRK |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line SiHa shows localization to plasma membrane & cell junctions. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate positivity in a subset of neural fibers. |
|
|
Immunohistochemical staining of human endometrium shows moderate positivity in apical membranes in glandular cells. |
|
|
Immunohistochemical staining of human prostate shows moderate positivity in apical membranes in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected. |
|
|
HPA054822-100ul |
|
|
|
|
|
HPA054822-100ul |
|
|
HPA054822-100ul |
Product Guarantee and Expert Support
