Anti-PTPRD
Artikelnummer:
ATA-HPA054829
- Bilder (8)
| Artikelname: | Anti-PTPRD |
| Artikelnummer: | ATA-HPA054829 |
| Hersteller Artikelnummer: | HPA054829 |
| Alternativnummer: | ATA-HPA054829-100,ATA-HPA054829-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HPTP, PTPD |
| protein tyrosine phosphatase, receptor type, D |
| Anti-PTPRD |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5789 |
| UniProt: | P23468 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PTPRD |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line RH-30 shows localization to vesicles. |
|
|
Immunohistochemical staining of human testis shows strong membranous positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human adrenal gland shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human skin shows no positivity in keratinocytes as expected. |
|
|
HPA054829-100ul |
|
|
|
|
|
HPA054829-100ul |
|
|
HPA054829-100ul |
Produktgarantie und fachkundiger Support
