Anti-PTPRD
Catalog Number:
ATA-HPA054829
- Images (8)
| Article Name: | Anti-PTPRD |
| Biozol Catalog Number: | ATA-HPA054829 |
| Supplier Catalog Number: | HPA054829 |
| Alternative Catalog Number: | ATA-HPA054829-100,ATA-HPA054829-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human, Mouse |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HPTP, PTPD |
| protein tyrosine phosphatase, receptor type, D |
| Anti-PTPRD |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 5789 |
| UniProt: | P23468 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PTPRD |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line RH-30 shows localization to vesicles. |
|
|
Immunohistochemical staining of human testis shows strong membranous positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human adrenal gland shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human skin shows no positivity in keratinocytes as expected. |
|
|
HPA054829-100ul |
|
|
|
|
|
HPA054829-100ul |
|
|
HPA054829-100ul |
Product Guarantee and Expert Support
