Anti-EEF1G
Artikelnummer:
ATA-HPA055316
- Bilder (8)
| Artikelname: | Anti-EEF1G |
| Artikelnummer: | ATA-HPA055316 |
| Hersteller Artikelnummer: | HPA055316 |
| Alternativnummer: | ATA-HPA055316-100,ATA-HPA055316-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | EF1G |
| eukaryotic translation elongation factor 1 gamma |
| Anti-EEF1G |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1937 |
| UniProt: | P26641 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | YTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | EEF1G |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human cerebellum, cerebral cortex, lymph node and testis using Anti-EEF1G antibody HPA055316 (A) shows similar protein distribution across tissues to independent antibody HPA040688 (B). |
|
|
Immunohistochemical staining of human cerebellum using Anti-EEF1G antibody HPA055316. |
|
|
Immunohistochemical staining of human lymph node using Anti-EEF1G antibody HPA055316. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-EEF1G antibody HPA055316. |
|
|
Immunohistochemical staining of human testis using Anti-EEF1G antibody HPA055316. |
|
|
HPA055316-100ul |
|
|
HPA055316-100ul |
|
|
HPA055316-100ul |
Produktgarantie und fachkundiger Support
