Anti-EEF1G
Catalog Number:
ATA-HPA055316
- Images (8)
| Article Name: | Anti-EEF1G |
| Biozol Catalog Number: | ATA-HPA055316 |
| Supplier Catalog Number: | HPA055316 |
| Alternative Catalog Number: | ATA-HPA055316-100,ATA-HPA055316-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | EF1G |
| eukaryotic translation elongation factor 1 gamma |
| Anti-EEF1G |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 1937 |
| UniProt: | P26641 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | EEF1G |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human cerebellum, cerebral cortex, lymph node and testis using Anti-EEF1G antibody HPA055316 (A) shows similar protein distribution across tissues to independent antibody HPA040688 (B). |
|
|
Immunohistochemical staining of human cerebellum using Anti-EEF1G antibody HPA055316. |
|
|
Immunohistochemical staining of human lymph node using Anti-EEF1G antibody HPA055316. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-EEF1G antibody HPA055316. |
|
|
Immunohistochemical staining of human testis using Anti-EEF1G antibody HPA055316. |
|
|
HPA055316-100ul |
|
|
HPA055316-100ul |
|
|
HPA055316-100ul |
Product Guarantee and Expert Support
