Anti-UHRF1
Artikelnummer:
ATA-HPA055446
- Bilder (8)
| Artikelname: | Anti-UHRF1 |
| Artikelnummer: | ATA-HPA055446 |
| Hersteller Artikelnummer: | HPA055446 |
| Alternativnummer: | ATA-HPA055446-100,ATA-HPA055446-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ21925, ICBP90, Np95, RNF106, TDRD22 |
| ubiquitin like with PHD and ring finger domains 1 |
| Anti-UHRF1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 29128 |
| UniProt: | Q96T88 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | UHRF1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human cerebral cortex, liver, lymph node and thymus using Anti-UHRF1 antibody HPA055446 (A) shows similar protein distribution across tissues to independent antibody HPA049408 (B). |
|
|
Immunohistochemical staining of human liver using Anti-UHRF1 antibody HPA055446. |
|
|
Immunohistochemical staining of human lymph node using Anti-UHRF1 antibody HPA055446. |
|
|
Immunohistochemical staining of human thymus using Anti-UHRF1 antibody HPA055446. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-UHRF1 antibody HPA055446. |
|
|
HPA055446-100ul |
|
|
HPA055446-100ul |
|
|
HPA055446-100ul |
Produktgarantie und fachkundiger Support
