Anti-UHRF1
Catalog Number:
ATA-HPA055446
- Images (8)
| Article Name: | Anti-UHRF1 |
| Biozol Catalog Number: | ATA-HPA055446 |
| Supplier Catalog Number: | HPA055446 |
| Alternative Catalog Number: | ATA-HPA055446-100,ATA-HPA055446-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ21925, ICBP90, Np95, RNF106, TDRD22 |
| ubiquitin like with PHD and ring finger domains 1 |
| Anti-UHRF1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 29128 |
| UniProt: | Q96T88 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | UHRF1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human cerebral cortex, liver, lymph node and thymus using Anti-UHRF1 antibody HPA055446 (A) shows similar protein distribution across tissues to independent antibody HPA049408 (B). |
|
|
Immunohistochemical staining of human liver using Anti-UHRF1 antibody HPA055446. |
|
|
Immunohistochemical staining of human lymph node using Anti-UHRF1 antibody HPA055446. |
|
|
Immunohistochemical staining of human thymus using Anti-UHRF1 antibody HPA055446. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-UHRF1 antibody HPA055446. |
|
|
HPA055446-100ul |
|
|
HPA055446-100ul |
|
|
HPA055446-100ul |
Product Guarantee and Expert Support
