Anti-NFE2L3

Artikelnummer: ATA-HPA055889
Artikelname: Anti-NFE2L3
Artikelnummer: ATA-HPA055889
Hersteller Artikelnummer: HPA055889
Alternativnummer: ATA-HPA055889-100,ATA-HPA055889-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Nrf3
nuclear factor, erythroid 2-like 3
Anti-NFE2L3
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 9603
UniProt: Q9Y4A8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LEGISLGDIPLPGSISDGMNSSAHYHVNFSQAISQDVNLHEAILLCPNNTFRRDPTARTSQSQEPFLQLNSHTTNPEQTLPGTNLTGFLSPVDNHMRNLTSQDLLYD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NFE2L3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & vesicles.
Immunohistochemistry analysis in human placenta and pancreas tissues using HPA055889 antibody. Corresponding NFE2L3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemical staining of human liver shows low positivity in hepatocytes as expected.
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
HPA055889-100ul