Anti-NFE2L3
Catalog Number:
ATA-HPA055889
- Images (8)
| Article Name: | Anti-NFE2L3 |
| Biozol Catalog Number: | ATA-HPA055889 |
| Supplier Catalog Number: | HPA055889 |
| Alternative Catalog Number: | ATA-HPA055889-100,ATA-HPA055889-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Nrf3 |
| nuclear factor, erythroid 2-like 3 |
| Anti-NFE2L3 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 9603 |
| UniProt: | Q9Y4A8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LEGISLGDIPLPGSISDGMNSSAHYHVNFSQAISQDVNLHEAILLCPNNTFRRDPTARTSQSQEPFLQLNSHTTNPEQTLPGTNLTGFLSPVDNHMRNLTSQDLLYD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NFE2L3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & vesicles. |
|
|
Immunohistochemistry analysis in human placenta and pancreas tissues using HPA055889 antibody. Corresponding NFE2L3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human liver shows low positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
HPA055889-100ul |
|
|
Product Guarantee and Expert Support
