Anti-MPC2
Artikelnummer:
ATA-HPA056091
- Bilder (7)
| Artikelname: | Anti-MPC2 |
| Artikelnummer: | ATA-HPA056091 |
| Hersteller Artikelnummer: | HPA056091 |
| Alternativnummer: | ATA-HPA056091-100,ATA-HPA056091-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BRP44, DKFZP564B167 |
| mitochondrial pyruvate carrier 2 |
| Anti-MPC2 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 25874 |
| UniProt: | O95563 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAEKLSTAQSAV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MPC2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity. |
|
|
HPA056091-100ul |
|
|
HPA056091-100ul |
|
|
HPA056091-100ul |
Produktgarantie und fachkundiger Support
