Anti-MPC2
Catalog Number:
ATA-HPA056091
- Images (7)
| Article Name: | Anti-MPC2 |
| Biozol Catalog Number: | ATA-HPA056091 |
| Supplier Catalog Number: | HPA056091 |
| Alternative Catalog Number: | ATA-HPA056091-100,ATA-HPA056091-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BRP44, DKFZP564B167 |
| mitochondrial pyruvate carrier 2 |
| Anti-MPC2 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 25874 |
| UniProt: | O95563 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAEKLSTAQSAV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MPC2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity. |
|
|
HPA056091-100ul |
|
|
HPA056091-100ul |
|
|
HPA056091-100ul |
Product Guarantee and Expert Support
