Anti-SOWAHC

Artikelnummer: ATA-HPA056131
Artikelname: Anti-SOWAHC
Artikelnummer: ATA-HPA056131
Hersteller Artikelnummer: HPA056131
Alternativnummer: ATA-HPA056131-100,ATA-HPA056131-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ANKRD57, C2orf26, FLJ21870
sosondowah ankyrin repeat domain family member C
Anti-SOWAHC
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 65124
UniProt: Q53LP3
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EAVLRFLAERGGRALHAELVQHFRGALGGEPEQRARARAHFKELVNAVATVRVDPADGAKYVHLKKRFCEGPSEPSGDPPRIQVTA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SOWAHC
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line PC-3 shows localization to cytosol.
Immunohistochemistry analysis in human esophagus and lymph node tissues using Anti-SOWAHC antibody. Corresponding SOWAHC RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human esophagus shows high expression.
Immunohistochemical staining of human lymph node shows low expression as expected.
HPA056131-100ul
HPA056131-100ul
HPA056131-100ul