Anti-SOWAHC
Catalog Number:
ATA-HPA056131
- Images (8)
| Article Name: | Anti-SOWAHC |
| Biozol Catalog Number: | ATA-HPA056131 |
| Supplier Catalog Number: | HPA056131 |
| Alternative Catalog Number: | ATA-HPA056131-100,ATA-HPA056131-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ANKRD57, C2orf26, FLJ21870 |
| sosondowah ankyrin repeat domain family member C |
| Anti-SOWAHC |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 65124 |
| UniProt: | Q53LP3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EAVLRFLAERGGRALHAELVQHFRGALGGEPEQRARARAHFKELVNAVATVRVDPADGAKYVHLKKRFCEGPSEPSGDPPRIQVTA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SOWAHC |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line PC-3 shows localization to cytosol. |
|
|
Immunohistochemistry analysis in human esophagus and lymph node tissues using Anti-SOWAHC antibody. Corresponding SOWAHC RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human esophagus shows high expression. |
|
|
Immunohistochemical staining of human lymph node shows low expression as expected. |
|
|
HPA056131-100ul |
|
|
|
|
|
HPA056131-100ul |
|
|
HPA056131-100ul |
Product Guarantee and Expert Support
