Anti-ATP1A3
Artikelnummer:
ATA-HPA056446
- Bilder (8)
| Artikelname: | Anti-ATP1A3 |
| Artikelnummer: | ATA-HPA056446 |
| Hersteller Artikelnummer: | HPA056446 |
| Alternativnummer: | ATA-HPA056446-100,ATA-HPA056446-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DYT12 |
| ATPase, Na+/K+ transporting, alpha 3 polypeptide |
| Anti-ATP1A3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 478 |
| UniProt: | P13637 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ATP1A3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human cerebral cortex and endometrium tissues using HPA056446 antibody. Corresponding ATP1A3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebellum shows strong membranous positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human prostate shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human endometrium shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil. |
|
|
HPA056446-100ul |
|
|
HPA056446-100ul |
|
|
HPA056446-100ul |
Produktgarantie und fachkundiger Support
