Anti-ATP1A3
Catalog Number:
ATA-HPA056446
- Images (8)
| Article Name: | Anti-ATP1A3 |
| Biozol Catalog Number: | ATA-HPA056446 |
| Supplier Catalog Number: | HPA056446 |
| Alternative Catalog Number: | ATA-HPA056446-100,ATA-HPA056446-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DYT12 |
| ATPase, Na+/K+ transporting, alpha 3 polypeptide |
| Anti-ATP1A3 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 478 |
| UniProt: | P13637 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ATP1A3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human cerebral cortex and endometrium tissues using HPA056446 antibody. Corresponding ATP1A3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebellum shows strong membranous positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human prostate shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human endometrium shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil. |
|
|
HPA056446-100ul |
|
|
HPA056446-100ul |
|
|
HPA056446-100ul |
Product Guarantee and Expert Support
