Anti-ARHGAP35
Artikelnummer:
ATA-HPA056470
- Bilder (9)
| Artikelname: | Anti-ARHGAP35 |
| Artikelnummer: | ATA-HPA056470 |
| Hersteller Artikelnummer: | HPA056470 |
| Alternativnummer: | ATA-HPA056470-100,ATA-HPA056470-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GRF-1, GRLF1, KIAA1722, P190A, p190ARhoGAP, p190RhoGAP |
| Rho GTPase activating protein 35 |
| Anti-ARHGAP35 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2909 |
| UniProt: | Q9NRY4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VNVDLAFSTLVQLIDKSRGKTKIIPYFEALKQQSQQIATAKDKYEWLVSRIVKNHNENWLSVSRKMQASPEYQDYVYLEGTQKAKKLF |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ARHGAP35 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies & aggresome. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells. |
|
|
HPA056470-100ul |
|
|
|
|
|
HPA056470-100ul |
|
|
HPA056470-100ul |
Produktgarantie und fachkundiger Support
