Anti-ARHGAP35, Rabbit, Polyclonal
Catalog Number:
ATA-HPA056470
Article Name: |
Anti-ARHGAP35, Rabbit, Polyclonal |
Biozol Catalog Number: |
ATA-HPA056470 |
Supplier Catalog Number: |
HPA056470 |
Alternative Catalog Number: |
ATA-HPA056470-25,ATA-HPA056470-100 |
Manufacturer: |
Atlas Antibodies |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
ICC, IHC |
Species Reactivity: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Conjugation: |
Unconjugated |
Alternative Names: |
GRF-1, GRLF1, KIAA1722, P190A, p190ARhoGAP, p190RhoGAP |
Rho GTPase activating protein 35 |
Clonality: |
Polyclonal |
Concentration: |
0.1 mg/ml |
Isotype: |
IgG |
NCBI: |
2909 |
UniProt: |
Q9NRY4 |
Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
Sequence: |
VNVDLAFSTLVQLIDKSRGKTKIIPYFEALKQQSQQIATAKDKYEWLVSRIVKNHNENWLSVSRKMQASPEYQDYVYLEGTQKAKKLF |
Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target: |
ARHGAP35 |
Antibody Type: |
Monoclonal Antibody |
Application Dilute: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies & aggresome. |
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts. |
|
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells. |
|
Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells. |
|
Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells. |
|
HPA056470 |
|
|
|
HPA056470 |
|
HPA056470 |