Anti-P2RX3
Artikelnummer:
ATA-HPA057776
- Bilder (7)
| Artikelname: | Anti-P2RX3 |
| Artikelnummer: | ATA-HPA057776 |
| Hersteller Artikelnummer: | HPA057776 |
| Alternativnummer: | ATA-HPA057776-100,ATA-HPA057776-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | P2X3 |
| purinergic receptor P2X, ligand-gated ion channel, 3 |
| Anti-P2RX3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5024 |
| UniProt: | P56373 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLGIKIGWVCDLDKAWDQCIPKY |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | P2RX3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human pancreas shows moderate membranous positivity in exocrine glandular cells. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes. |
|
|
Immunohistochemical staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes. |
|
|
HPA057776-100ul |
|
|
HPA057776-100ul |
|
|
HPA057776-100ul |
Produktgarantie und fachkundiger Support
