Anti-P2RX3
Catalog Number:
ATA-HPA057776
- Images (7)
| Article Name: | Anti-P2RX3 |
| Biozol Catalog Number: | ATA-HPA057776 |
| Supplier Catalog Number: | HPA057776 |
| Alternative Catalog Number: | ATA-HPA057776-100,ATA-HPA057776-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | P2X3 |
| purinergic receptor P2X, ligand-gated ion channel, 3 |
| Anti-P2RX3 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 5024 |
| UniProt: | P56373 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLGIKIGWVCDLDKAWDQCIPKY |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | P2RX3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human pancreas shows moderate membranous positivity in exocrine glandular cells. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes. |
|
|
Immunohistochemical staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes. |
|
|
HPA057776-100ul |
|
|
HPA057776-100ul |
|
|
HPA057776-100ul |
Product Guarantee and Expert Support
