Anti-IDH1

Artikelnummer: ATA-HPA057936
Artikelname: Anti-IDH1
Artikelnummer: ATA-HPA057936
Hersteller Artikelnummer: HPA057936
Alternativnummer: ATA-HPA057936-100,ATA-HPA057936-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Pan-Cancer
isocitrate dehydrogenase 1 (NADP+), soluble
Anti-IDH1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 3417
UniProt: O75874
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: IDH1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human prostate and skeletal muscle tissues using Anti-IDH1 antibody. Corresponding IDH1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human prostate shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-IDH1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line HepG2
HPA057936-100ul
HPA057936-100ul
HPA057936-100ul