Anti-IDH1

Catalog Number: ATA-HPA057936
Article Name: Anti-IDH1
Biozol Catalog Number: ATA-HPA057936
Supplier Catalog Number: HPA057936
Alternative Catalog Number: ATA-HPA057936-100,ATA-HPA057936-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Pan-Cancer
isocitrate dehydrogenase 1 (NADP+), soluble
Anti-IDH1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 3417
UniProt: O75874
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: IDH1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human prostate and skeletal muscle tissues using Anti-IDH1 antibody. Corresponding IDH1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human prostate shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-IDH1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line HepG2
HPA057936-100ul
HPA057936-100ul
HPA057936-100ul