Anti-HSD17B6
Artikelnummer:
ATA-HPA059141
- Bilder (7)
| Artikelname: | Anti-HSD17B6 |
| Artikelnummer: | ATA-HPA059141 |
| Hersteller Artikelnummer: | HPA059141 |
| Alternativnummer: | ATA-HPA059141-100,ATA-HPA059141-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HSE, RODH, SDR9C6 |
| hydroxysteroid (17-beta) dehydrogenase 6 |
| Anti-HSD17B6 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8630 |
| UniProt: | O14756 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HSD17B6 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human liver and pancreas tissues using HPA059141 antibody. Corresponding HSD17B6 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity as expected. |
|
|
HPA059141-100ul |
|
|
HPA059141-100ul |
|
|
HPA059141-100ul |
Produktgarantie und fachkundiger Support
