Anti-HSD17B6
Catalog Number:
ATA-HPA059141
- Images (7)
| Article Name: | Anti-HSD17B6 |
| Biozol Catalog Number: | ATA-HPA059141 |
| Supplier Catalog Number: | HPA059141 |
| Alternative Catalog Number: | ATA-HPA059141-100,ATA-HPA059141-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HSE, RODH, SDR9C6 |
| hydroxysteroid (17-beta) dehydrogenase 6 |
| Anti-HSD17B6 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 8630 |
| UniProt: | O14756 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HSD17B6 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human liver and pancreas tissues using HPA059141 antibody. Corresponding HSD17B6 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity as expected. |
|
|
HPA059141-100ul |
|
|
HPA059141-100ul |
|
|
HPA059141-100ul |
Product Guarantee and Expert Support
