Anti-KRT79
Artikelnummer:
ATA-HPA059347
- Bilder (7)
| Artikelname: | Anti-KRT79 |
| Artikelnummer: | ATA-HPA059347 |
| Hersteller Artikelnummer: | HPA059347 |
| Alternativnummer: | ATA-HPA059347-100,ATA-HPA059347-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | K6L, KRT6L |
| keratin 79 |
| Anti-KRT79 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 338785 |
| UniProt: | Q5XKE5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MRSSVSRQTYSTKGGFSSNSASGGSGSQARTSFSSVTVSRSSGSGGGAHCGPGTGGFGS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | KRT79 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human skin and skeletal muscle tissues using Anti-KRT79 antibody. Corresponding KRT79 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skin shows high expression. |
|
|
Immunohistochemical staining of human hair shows strong cytoplasmic positivity in external root sheath. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
HPA059347-100ul |
|
|
HPA059347-100ul |
|
|
HPA059347-100ul |
Produktgarantie und fachkundiger Support
