Anti-KRT79
Catalog Number:
ATA-HPA059347
- Images (7)
| Article Name: | Anti-KRT79 |
| Biozol Catalog Number: | ATA-HPA059347 |
| Supplier Catalog Number: | HPA059347 |
| Alternative Catalog Number: | ATA-HPA059347-100,ATA-HPA059347-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | K6L, KRT6L |
| keratin 79 |
| Anti-KRT79 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 338785 |
| UniProt: | Q5XKE5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MRSSVSRQTYSTKGGFSSNSASGGSGSQARTSFSSVTVSRSSGSGGGAHCGPGTGGFGS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | KRT79 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human skin and skeletal muscle tissues using Anti-KRT79 antibody. Corresponding KRT79 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skin shows high expression. |
|
|
Immunohistochemical staining of human hair shows strong cytoplasmic positivity in external root sheath. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
HPA059347-100ul |
|
|
HPA059347-100ul |
|
|
HPA059347-100ul |
Product Guarantee and Expert Support
