Anti-VPS33B, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA059834
| Artikelname: |
Anti-VPS33B, Rabbit, Polyclonal |
| Artikelnummer: |
ATA-HPA059834 |
| Hersteller Artikelnummer: |
HPA059834 |
| Alternativnummer: |
ATA-HPA059834-100,ATA-HPA059834-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Alternative Synonym: |
FLJ14848 |
| Rabbit Polyclonal VPS33B Antibody against Human VPS33B late endosome and lysosome associated. Validated for Western Blot |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.1 |
| NCBI: |
26276 |
| UniProt: |
Q9H267 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequenz: |
KLVTDKAAGKITDAFSSLAKRSNFRAISKKLNLIPRVDGEYDLKVPRDMAYVFSGAYVPLSCRIIEQVLERRSWQGLDEVVRLLNCSDFAFTDMTKED |