Anti-VPS33B
Catalog Number:
ATA-HPA059834
| Article Name: |
Anti-VPS33B |
| Biozol Catalog Number: |
ATA-HPA059834 |
| Supplier Catalog Number: |
HPA059834 |
| Alternative Catalog Number: |
ATA-HPA059834-100,ATA-HPA059834-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
FLJ14848 |
| Rabbit Polyclonal VPS33B Antibody against Human VPS33B late endosome and lysosome associated. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.1 |
| NCBI: |
26276 |
| UniProt: |
Q9H267 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
KLVTDKAAGKITDAFSSLAKRSNFRAISKKLNLIPRVDGEYDLKVPRDMAYVFSGAYVPLSCRIIEQVLERRSWQGLDEVVRLLNCSDFAFTDMTKED |
|
WB Image Caption 1 |