Anti-VPS33B, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-VPS33B, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA059834
• Supplier Catalog Number: HPA059834
• Alternative Catalog Number: ATA-HPA059834-100,ATA-HPA059834-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: FLJ14848

Product Description

Rabbit Polyclonal VPS33B Antibody against Human VPS33B late endosome and lysosome associated. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1
• NCBI: 26276
• UniProt: Q9H267
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: KLVTDKAAGKITDAFSSLAKRSNFRAISKKLNLIPRVDGEYDLKVPRDMAYVFSGAYVPLSCRIIEQVLERRSWQGLDEVVRLLNCSDFAFTDMTKED