Anti-DNAJB13

Artikelnummer: ATA-HPA061330
Artikelname: Anti-DNAJB13
Artikelnummer: ATA-HPA061330
Hersteller Artikelnummer: HPA061330
Alternativnummer: ATA-HPA061330-100,ATA-HPA061330-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Molekularbiologie
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: RSPH16A, TSARG6
DnaJ heat shock protein family (Hsp40) member B13
Anti-DNAJB13
Klonalität: Polyclonal
Konzentration: 0.4 mg/ml
Isotyp: IgG
NCBI: 374407
UniProt: P59910
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: WTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DNAJB13
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line PC-3 shows localization to plasma membrane.
HPA061330-100ul