Anti-DNAJB13

Catalog Number: ATA-HPA061330
Article Name: Anti-DNAJB13
Biozol Catalog Number: ATA-HPA061330
Supplier Catalog Number: HPA061330
Alternative Catalog Number: ATA-HPA061330-100,ATA-HPA061330-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Molekularbiologie
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: RSPH16A, TSARG6
DnaJ heat shock protein family (Hsp40) member B13
Anti-DNAJB13
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 374407
UniProt: P59910
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: WTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DNAJB13
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line PC-3 shows localization to plasma membrane.
HPA061330-100ul