Anti-CDC42BPG
Artikelnummer:
ATA-HPA061836
- Bilder (7)
| Artikelname: | Anti-CDC42BPG |
| Artikelnummer: | ATA-HPA061836 |
| Hersteller Artikelnummer: | HPA061836 |
| Alternativnummer: | ATA-HPA061836-100,ATA-HPA061836-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DMPK2, HSMDPKIN, kappa-200, MRCKgamma |
| CDC42 binding protein kinase gamma (DMPK-like) |
| Anti-CDC42BPG |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 55561 |
| UniProt: | Q6DT37 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SNDIFQVGECRRVQQLTLSPSAGLLVVLCGRGPSVRLFALAELENIEVAGAKIPESRGCQVLAAGSILQARTPVLCV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CDC42BPG |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human cervix, uterine shows positivity in epidermal cells. |
|
|
Immunohistochemical staining of human oral mucosa shows positivity in epidermal cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows positivity in neuropil. |
|
|
Immunohistochemical staining of human cerebellum shows positivity in neuropil. |
|
|
HPA061836-100ul |
|
|
HPA061836-100ul |
|
|
HPA061836-100ul |
Produktgarantie und fachkundiger Support
