Anti-CDC42BPG
Catalog Number:
ATA-HPA061836
- Images (7)
| Article Name: | Anti-CDC42BPG |
| Biozol Catalog Number: | ATA-HPA061836 |
| Supplier Catalog Number: | HPA061836 |
| Alternative Catalog Number: | ATA-HPA061836-100,ATA-HPA061836-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DMPK2, HSMDPKIN, kappa-200, MRCKgamma |
| CDC42 binding protein kinase gamma (DMPK-like) |
| Anti-CDC42BPG |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 55561 |
| UniProt: | Q6DT37 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SNDIFQVGECRRVQQLTLSPSAGLLVVLCGRGPSVRLFALAELENIEVAGAKIPESRGCQVLAAGSILQARTPVLCV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CDC42BPG |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human cervix, uterine shows positivity in epidermal cells. |
|
|
Immunohistochemical staining of human oral mucosa shows positivity in epidermal cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows positivity in neuropil. |
|
|
Immunohistochemical staining of human cerebellum shows positivity in neuropil. |
|
|
HPA061836-100ul |
|
|
HPA061836-100ul |
|
|
HPA061836-100ul |
Product Guarantee and Expert Support
