Anti-TGIF1
Artikelnummer:
ATA-HPA062160
- Bilder (7)
| Artikelname: | Anti-TGIF1 |
| Artikelnummer: | ATA-HPA062160 |
| Hersteller Artikelnummer: | HPA062160 |
| Alternativnummer: | ATA-HPA062160-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ChIP, ICC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HPE4, TGIF |
| TGFB-induced factor homeobox 1 |
| Anti-TGIF1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 7050 |
| UniProt: | Q15583 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TGIF1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm. |
|
|
Western blot analysis in human cell lines A-549 and HEK293 using Anti-TGIF1 antibody. Corresponding TGIF1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Western blot analysis in human cell line RT-4. |
|
|
HPA062160-100ul |
|
|
HPA062160-100ul |
|
|
HPA062160 |
|
|
HPA062160-100ul |
Produktgarantie und fachkundiger Support
