Anti-TGIF1
Catalog Number:
ATA-HPA062160
- Images (7)
| Article Name: | Anti-TGIF1 |
| Biozol Catalog Number: | ATA-HPA062160 |
| Supplier Catalog Number: | HPA062160 |
| Alternative Catalog Number: | ATA-HPA062160-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ChIP, ICC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HPE4, TGIF |
| TGFB-induced factor homeobox 1 |
| Anti-TGIF1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 7050 |
| UniProt: | Q15583 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TGIF1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm. |
|
|
Western blot analysis in human cell lines A-549 and HEK293 using Anti-TGIF1 antibody. Corresponding TGIF1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Western blot analysis in human cell line RT-4. |
|
|
HPA062160-100ul |
|
|
HPA062160-100ul |
|
|
HPA062160 |
|
|
HPA062160-100ul |
Product Guarantee and Expert Support
