Anti-MAGEC2
Artikelnummer:
ATA-HPA062230
- Bilder (8)
| Artikelname: | Anti-MAGEC2 |
| Artikelnummer: | ATA-HPA062230 |
| Hersteller Artikelnummer: | HPA062230 |
| Alternativnummer: | ATA-HPA062230-100,ATA-HPA062230-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CT10, MAGE-C2, MAGEE1 |
| melanoma antigen family C, 2 |
| Anti-MAGEC2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 51438 |
| UniProt: | Q9UBF1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASSASSTLYLVFSPS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MAGEC2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli. |
|
|
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-MAGEC2 antibody. Corresponding MAGEC2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human endometrium shows low expression as expected. |
|
|
HPA062230-100ul |
|
|
|
|
|
HPA062230-100ul |
|
|
HPA062230-100ul |
Produktgarantie und fachkundiger Support
