Anti-MAGEC2

Catalog Number: ATA-HPA062230
Article Name: Anti-MAGEC2
Biozol Catalog Number: ATA-HPA062230
Supplier Catalog Number: HPA062230
Alternative Catalog Number: ATA-HPA062230-100,ATA-HPA062230-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CT10, MAGE-C2, MAGEE1
melanoma antigen family C, 2
Anti-MAGEC2
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 51438
UniProt: Q9UBF1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASSASSTLYLVFSPS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MAGEC2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli.
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-MAGEC2 antibody. Corresponding MAGEC2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human endometrium shows low expression as expected.
HPA062230-100ul
HPA062230-100ul
HPA062230-100ul