Anti-TCHHL1
Artikelnummer:
ATA-HPA063483
- Bilder (8)
| Artikelname: | Anti-TCHHL1 |
| Artikelnummer: | ATA-HPA063483 |
| Hersteller Artikelnummer: | HPA063483 |
| Alternativnummer: | ATA-HPA063483-100,ATA-HPA063483-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | S100A17, THHL1 |
| trichohyalin-like 1 |
| Anti-TCHHL1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Isotyp: | IgG |
| NCBI: | 126637 |
| UniProt: | Q5QJ38 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RDQEPCSVERGAVYSSPLYQYLQEKILQQTNVTQEEHQKQVQIAQASGPELCSVSLTSEISDCSVFFNYSQASQPYTRGLPLDESPAGAQETPAPQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TCHHL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemical staining of human cerebral cortex, kidney, lymph node and skin, hairy using Anti-TCHHL1 antibody HPA063483 (A) shows similar protein distribution across tissues to independent antibody HPA042579 (B). |
|
|
Immunohistochemical staining of human kidney using Anti-TCHHL1 antibody HPA063483. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-TCHHL1 antibody HPA063483. |
|
|
Immunohistochemical staining of human lymph node using Anti-TCHHL1 antibody HPA063483. |
|
|
Immunohistochemical staining of human skin, hairy using Anti-TCHHL1 antibody HPA063483. |
|
|
HPA063483-100ul |
|
|
HPA063483-100ul |
|
|
HPA063483-100ul |
Produktgarantie und fachkundiger Support
