Anti-TCHHL1
Catalog Number:
ATA-HPA063483
- Images (8)
| Article Name: | Anti-TCHHL1 |
| Biozol Catalog Number: | ATA-HPA063483 |
| Supplier Catalog Number: | HPA063483 |
| Alternative Catalog Number: | ATA-HPA063483-100,ATA-HPA063483-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | S100A17, THHL1 |
| trichohyalin-like 1 |
| Anti-TCHHL1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Isotype: | IgG |
| NCBI: | 126637 |
| UniProt: | Q5QJ38 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RDQEPCSVERGAVYSSPLYQYLQEKILQQTNVTQEEHQKQVQIAQASGPELCSVSLTSEISDCSVFFNYSQASQPYTRGLPLDESPAGAQETPAPQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TCHHL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemical staining of human cerebral cortex, kidney, lymph node and skin, hairy using Anti-TCHHL1 antibody HPA063483 (A) shows similar protein distribution across tissues to independent antibody HPA042579 (B). |
|
|
Immunohistochemical staining of human kidney using Anti-TCHHL1 antibody HPA063483. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-TCHHL1 antibody HPA063483. |
|
|
Immunohistochemical staining of human lymph node using Anti-TCHHL1 antibody HPA063483. |
|
|
Immunohistochemical staining of human skin, hairy using Anti-TCHHL1 antibody HPA063483. |
|
|
HPA063483-100ul |
|
|
HPA063483-100ul |
|
|
HPA063483-100ul |
Product Guarantee and Expert Support
