Anti-SLC18A1
Artikelnummer:
ATA-HPA063797
- Bilder (8)
| Artikelname: | Anti-SLC18A1 |
| Artikelnummer: | ATA-HPA063797 |
| Hersteller Artikelnummer: | HPA063797 |
| Alternativnummer: | ATA-HPA063797-100,ATA-HPA063797-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CGAT, VAT1, VMAT1 |
| solute carrier family 18 (vesicular monoamine transporter), member 1 |
| Anti-SLC18A1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6570 |
| UniProt: | P54219 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC18A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemistry analysis in human adrenal gland and pancreas tissues using HPA063797 antibody. Corresponding SLC18A1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human adrenal gland shows moderate cytoplasmic positivity in medullary cells. |
|
|
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in neuroendocrine cells. |
|
|
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in neuroendocrine cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
HPA063797-100ul |
|
|
HPA063797-100ul |
|
|
HPA063797-100ul |
Produktgarantie und fachkundiger Support
