Anti-SLC18A1
Catalog Number:
ATA-HPA063797
- Images (8)
| Article Name: | Anti-SLC18A1 |
| Biozol Catalog Number: | ATA-HPA063797 |
| Supplier Catalog Number: | HPA063797 |
| Alternative Catalog Number: | ATA-HPA063797-100,ATA-HPA063797-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CGAT, VAT1, VMAT1 |
| solute carrier family 18 (vesicular monoamine transporter), member 1 |
| Anti-SLC18A1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 6570 |
| UniProt: | P54219 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC18A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemistry analysis in human adrenal gland and pancreas tissues using HPA063797 antibody. Corresponding SLC18A1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human adrenal gland shows moderate cytoplasmic positivity in medullary cells. |
|
|
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in neuroendocrine cells. |
|
|
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in neuroendocrine cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
HPA063797-100ul |
|
|
HPA063797-100ul |
|
|
HPA063797-100ul |
Product Guarantee and Expert Support
