Anti-TM9SF4
Artikelnummer:
ATA-HPA064099
- Bilder (8)
| Artikelname: | Anti-TM9SF4 |
| Artikelnummer: | ATA-HPA064099 |
| Hersteller Artikelnummer: | HPA064099 |
| Alternativnummer: | ATA-HPA064099-100,ATA-HPA064099-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | dJ836N17.2, KIAA0255 |
| transmembrane 9 superfamily protein member 4 |
| Anti-TM9SF4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9777 |
| UniProt: | Q92544 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TM9SF4 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line CACO-2 shows localization to mitochondria. |
|
|
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line CACO-2 |
|
|
HPA064099-100ul |
|
|
|
|
|
|
|
|
HPA064099-100ul |
|
|
HPA064099-100ul |
Produktgarantie und fachkundiger Support
