Anti-TM9SF4

Catalog Number: ATA-HPA064099
Article Name: Anti-TM9SF4
Biozol Catalog Number: ATA-HPA064099
Supplier Catalog Number: HPA064099
Alternative Catalog Number: ATA-HPA064099-100,ATA-HPA064099-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: dJ836N17.2, KIAA0255
transmembrane 9 superfamily protein member 4
Anti-TM9SF4
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 9777
UniProt: Q92544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TM9SF4
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line CACO-2 shows localization to mitochondria.
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line CACO-2
HPA064099-100ul
HPA064099-100ul
HPA064099-100ul