Anti-BHLHE22
Artikelnummer:
ATA-HPA064128
- Bilder (8)
| Artikelname: | Anti-BHLHE22 |
| Artikelnummer: | ATA-HPA064128 |
| Hersteller Artikelnummer: | HPA064128 |
| Alternativnummer: | ATA-HPA064128-100,ATA-HPA064128-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Beta3, BHLHB5, bHLHe22, CAGL85, TNRC20 |
| basic helix-loop-helix family, member e22 |
| Anti-BHLHE22 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.6 mg/ml |
| Isotyp: | IgG |
| NCBI: | 27319 |
| UniProt: | Q8NFJ8 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AAAAALHPALGAYEQAAGYPFSAGLPPAASCPEKCALFNSVSSSLCKQCTE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | BHLHE22 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human cerebellum, colon, liver and testis using Anti-BHLHE22 antibody HPA064128 (A) shows similar protein distribution across tissues to independent antibody HPA064872 (B). |
|
|
Immunohistochemical staining of human liver using Anti-BHLHE22 antibody HPA064128. |
|
|
Immunohistochemical staining of human colon using Anti-BHLHE22 antibody HPA064128. |
|
|
Immunohistochemical staining of human cerebellum using Anti-BHLHE22 antibody HPA064128. |
|
|
Immunohistochemical staining of human testis using Anti-BHLHE22 antibody HPA064128. |
|
|
HPA064128-100ul |
|
|
HPA064128-100ul |
|
|
HPA064128-100ul |
Produktgarantie und fachkundiger Support
