Anti-BHLHE22
Catalog Number:
ATA-HPA064128
- Images (8)
| Article Name: | Anti-BHLHE22 |
| Biozol Catalog Number: | ATA-HPA064128 |
| Supplier Catalog Number: | HPA064128 |
| Alternative Catalog Number: | ATA-HPA064128-100,ATA-HPA064128-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Beta3, BHLHB5, bHLHe22, CAGL85, TNRC20 |
| basic helix-loop-helix family, member e22 |
| Anti-BHLHE22 |
| Clonality: | Polyclonal |
| Concentration: | 0.6 mg/ml |
| Isotype: | IgG |
| NCBI: | 27319 |
| UniProt: | Q8NFJ8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | AAAAALHPALGAYEQAAGYPFSAGLPPAASCPEKCALFNSVSSSLCKQCTE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | BHLHE22 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human cerebellum, colon, liver and testis using Anti-BHLHE22 antibody HPA064128 (A) shows similar protein distribution across tissues to independent antibody HPA064872 (B). |
|
|
Immunohistochemical staining of human liver using Anti-BHLHE22 antibody HPA064128. |
|
|
Immunohistochemical staining of human colon using Anti-BHLHE22 antibody HPA064128. |
|
|
Immunohistochemical staining of human cerebellum using Anti-BHLHE22 antibody HPA064128. |
|
|
Immunohistochemical staining of human testis using Anti-BHLHE22 antibody HPA064128. |
|
|
HPA064128-100ul |
|
|
HPA064128-100ul |
|
|
HPA064128-100ul |
Product Guarantee and Expert Support
