Anti-PVR

Artikelnummer: ATA-HPA064739
Artikelname: Anti-PVR
Artikelnummer: ATA-HPA064739
Hersteller Artikelnummer: HPA064739
Alternativnummer: ATA-HPA064739-100,ATA-HPA064739-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD155, HVED, Necl-5, NECL5, PVS, Tage4
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 5817
UniProt: P15151
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILV
Target-Kategorie: PVR
Antibody Type: Monoclonal Antibody
HPA064739-100ul