Anti-PVR

Catalog Number: ATA-HPA064739
Article Name: Anti-PVR
Biozol Catalog Number: ATA-HPA064739
Supplier Catalog Number: HPA064739
Alternative Catalog Number: ATA-HPA064739-100,ATA-HPA064739-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CD155, HVED, Necl-5, NECL5, PVS, Tage4
Clonality: Polyclonal
Isotype: IgG
NCBI: 5817
UniProt: P15151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILV
Target: PVR
Antibody Type: Monoclonal Antibody
HPA064739-100ul